PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G391500.1.p
Common NameSb01g037110, SORBIDRAFT_01g037110
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 337aa    MW: 36771.9 Da    PI: 4.6937
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G391500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.12.3e-192269148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          rg+WT eEd+llv++v+ +G g+W++ ar  g++Rt+k+c++rw++yl
  Sobic.001G391500.1.p 22 RGPWTVEEDLLLVNYVAAHGEGRWNSLARSAGLKRTGKSCRLRWLNYL 69
                          89********************************************97 PP

2Myb_DNA-binding51.81.9e-1675118146
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           rg+ T++E++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  Sobic.001G391500.1.p  75 RGNITPQEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 118
                           7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.7521773IPR017930Myb domain
SuperFamilySSF466893.4E-3120116IPR009057Homeodomain-like
SMARTSM007176.2E-162171IPR001005SANT/Myb domain
PfamPF002491.7E-172269IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-232376IPR009057Homeodomain-like
CDDcd001673.02E-122469No hitNo description
SMARTSM007176.2E-1574122IPR001005SANT/Myb domain
PROSITE profilePS5129418.87374124IPR017930Myb domain
PfamPF002492.3E-1575118IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-2377123IPR009057Homeodomain-like
CDDcd001672.20E-1179118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MDMAHERDAS SEEEVMAGEL RRGPWTVEED LLLVNYVAAH GEGRWNSLAR SAGLKRTGKS  60
CRLRWLNYLR PDLRRGNITP QEQLLILELH SRWGNRWSKI AQHLPGRTDN EIKNYWRTRV  120
QKHAKQLKCD VNSQQFKDVM RYLWMPRLVE RIQAAAANAS AGGAPPQPGA AADTPLSSSW  180
QQGGADDGLY ASPEELPTDA CSWPPADCYY PAAVGDGDHH QLLMMNNPAV GPELSSTTAG  240
SSSPSSDSGA GAQPCWLVAP VGGAEWFTTA CDASSAVLAG QQQQQQQSSC LLGETTTWAS  300
SELPELGVAD FEIGSFDVES IWSMDDNLWF TQAQGV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-251312218126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794340.0HF679434.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB28 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002465358.10.0hypothetical protein SORBIDRAFT_01g037110
TrEMBLC5X1V40.0C5X1V4_SORBI; Putative uncharacterized protein Sb01g037110
STRINGSb01g037110.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.12e-83myb domain protein 112